PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g23967.1.p
Common NameBRADI_4g23967, LOC100835967
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 266aa    MW: 29031.7 Da    PI: 8.2845
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g23967.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd +lv ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Bradi4g23967.1.p 14 KGAWTKEEDGRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                      79******************************99************97 PP

2Myb_DNA-binding61.22.1e-1967111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg++T+eEdel+++++++lG++ W++Ia +++ gRt++++k++w+++
  Bradi4g23967.1.p  67 RGNFTEEEDELIIKLHQLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                       89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-23564IPR009057Homeodomain-like
PROSITE profilePS5129415.435961IPR017930Myb domain
SMARTSM007171.2E-111363IPR001005SANT/Myb domain
SuperFamilySSF466891.26E-2913108IPR009057Homeodomain-like
PfamPF002497.1E-141461IPR001005SANT/Myb domain
CDDcd001675.15E-101661No hitNo description
PROSITE profilePS5129429.19862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.6E-2965116IPR009057Homeodomain-like
SMARTSM007172.8E-1866114IPR001005SANT/Myb domain
PfamPF002491.4E-1767111IPR001005SANT/Myb domain
CDDcd001671.33E-1469112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDGRLVAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHQLLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLARG  120
VDPHTHRPLN AAAANAMPPH QQQLQPHFAA AGHNHQQDHP PACSSGSGSD EDDEPSGSAT  180
PPPSRHAGLG IDLNLSISLA PYQPTSQEPD RPAAAVCLCL NRLGLFQDDA GGKGCICGAA  240
EQQQQASAQR QHMFRFIAPL EQGGQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0630271e-134AK063027.1 Oryza sativa Japonica Group cDNA clone:001-110-B12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576234.10.0PREDICTED: myb-related protein 308
SwissprotP813939e-92MYB08_ANTMA; Myb-related protein 308
TrEMBLI1IN050.0I1IN05_BRADI; Uncharacterized protein
STRINGBRADI4G23967.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-88myb domain protein 4